PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_019152-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 707aa    MW: 78669.8 Da    PI: 5.4632
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_019152-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.4e-1852106256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +k t++t++q++eLe++F  + +p++++r e  +klgL+ +qVk+WFqNrR++ k
  AHYPO_019152-RA  52 KKCTRHTPQQIQELENFFSICAHPNEAQRLEFGRKLGLDSKQVKFWFQNRRTQLK 106
                      56699**********************************************9987 PP

2START140.12.2e-442534723203
                      HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
            START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                      a +a++e++++a+ ++p+W k      e ++ de+++kf+ s +     ++++a+r++g v     +lve+++d + +W+ t++    ka+  e
  AHYPO_019152-RA 253 AMAAMDEVLALAQTDSPLWYKGLhgdkEVLIHDEYMKKFAGSFGkkpcgFKTDASRETGSVLISGLELVEIMMDAS-RWQDTFPcmisKAAFEE 345
                      5689*******************9999999*********6654499********************9***999999.***************** PP

                      EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
            START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                       ++sg      g+lql +ae+ ++splvp R   ++Ry++q+ +g w++vd+Svd  ++   + s+v+ ++lpSg++i++++ g+s vtw+ehv
  AHYPO_019152-RA 346 LVCSGvggtrdGELQLLNAEFIFPSPLVPfRQEKILRYCKQHLGGMWTVVDISVDLIRESLFEGSCVKWRRLPSGCIIHDVGHGYSMVTWIEHV 439
                      **********************************************************9755******************************** PP

                      E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXX CS
            START 171 dlkgrlphwllrslvksglaegaktwvatlqrq 203
                      +++++ +h+l+rsl++sg a+g ++w+atlqr 
  AHYPO_019152-RA 440 EYDEKYIHQLYRSLLRSGKAFGSQKWLATLQRE 472
                      *******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-1825111IPR009057Homeodomain-like
SuperFamilySSF466893.12E-1836109IPR009057Homeodomain-like
PROSITE profilePS5007116.30948108IPR001356Homeobox domain
SMARTSM003898.2E-1649112IPR001356Homeobox domain
PfamPF000465.8E-1652106IPR001356Homeobox domain
CDDcd000866.23E-1655109No hitNo description
PROSITE profilePS5084831.881242471IPR002913START domain
SuperFamilySSF559615.77E-22243471No hitNo description
CDDcd088752.47E-86246471No hitNo description
SMARTSM002341.1E-29251475IPR002913START domain
PfamPF018524.0E-37253472IPR002913START domain
SuperFamilySSF559615.92E-8479644No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MEGQGQLVIY GEPFNQNNLQ VVEKEDSGSD NSEDFPEGPS QNQNNNNDQR TKKCTRHTPQ  60
QIQELENFFS ICAHPNEAQR LEFGRKLGLD SKQVKFWFQN RRTQLKSQKE RHENVVLKQE  120
YDKIMHENIV LKDAISNPFC QICGAPNFPR EISMGQHNLR VEIDRLKDEL TRVCSAAEKL  180
LGKPITDYIG PISVLTPSFN LDLSMGRGEM NGLMSPPSPL LITMGPNIET GGPSNTSLTA  240
CSDYEKSVYM QAAMAAMDEV LALAQTDSPL WYKGLHGDKE VLIHDEYMKK FAGSFGKKPC  300
GFKTDASRET GSVLISGLEL VEIMMDASRW QDTFPCMISK AAFEELVCSG VGGTRDGELQ  360
LLNAEFIFPS PLVPFRQEKI LRYCKQHLGG MWTVVDISVD LIRESLFEGS CVKWRRLPSG  420
CIIHDVGHGY SMVTWIEHVE YDEKYIHQLY RSLLRSGKAF GSQKWLATLQ RERDVGIVTP  480
EGKKSVLKLM RRLSNNFCAG LCGASACRWE KLQAGGLAAD LCVMSRVGLN EPGEPSGVVL  540
SASTSIWVPV PRQDLFDFLR DEKLRAEWDI LADGGPLEVI SRLFKSHDEN NCVSILCPQE  600
SWTDRTGSFI VYGPVDSASI WSVLRGEDSD FVILLPSGFV ISDAPMVGDL PSLANDNKTG  660
VASALTVGFQ IMVNNLPNSN LTRESINTVN DLMSCTIKKI RLSLGI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010693469.10.0PREDICTED: homeobox-leucine zipper protein HDG1-like isoform X1
TrEMBLA0A0J8BGB90.0A0A0J8BGB9_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein